SCOPe 2.08: Domain d5nx3c_: 5nx3 C:

Lineage for d5nx3c_ (5nx3 C:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)

8. Domain d5nx3c_: 5nx3 C: [352935]
   Other proteins in same PDB: d5nx3a_
   automated match to d1zjdb_

Details for d5nx3c_

PDB Entry: 5nx3, 2.3 Å

PDB Description: combinatorial engineering of proteolytically resistant appi variants that selectively inhibit human kallikrein 6 for cancer therapy

PDB Compounds: (C:) Amyloid-beta A4 protein

SCOPe Domain Sequences for d5nx3c_:

Sequence; same for both SEQRES and ATOM records:

>d5nx3c_ g.8.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpcralffrwyfdvtegkcapfvyggcggnrnnfdteeycmavc

Timeline for d5nx3c_:

• d5nx3c_ first appeared in SCOPe 2.07