Lineage for d1oasa_ (1oas A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins) 
Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (2 species) 
Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries) 
Domain d1oasa_: 1oas A: [35293]
Details for d1oasa_
PDB Entry: 1oas (more details), 2.2 Å
PDB Description: o-acetylserine sulfhydrylase from salmonella typhimurium
SCOP Domain Sequences for d1oasa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oasa_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium}
skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sgerylstalfadlf
SCOP Domain Coordinates for d1oasa_:
Click to download the PDB-style file with coordinates for d1oasa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oasa_:
- d1oasa_ first appeared (with stable ids) in SCOP 1.55
- d1oasa_ appears in SCOP 1.59
- d1oasa_ appears in SCOP 1.63
- d1oasa_ appears in the current release, SCOPe 2.08
View in 3D
