SCOPe 2.07: Domain d3f51e1: 3f51 E:19-107

Lineage for d3f51e1 (3f51 E:19-107)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (17 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [346176] (2 PDB entries)

8. Domain d3f51e1: 3f51 E:19-107 [352928]
   Other proteins in same PDB: d3f51c2, d3f51d2, d3f51e2, d3f51f2
   automated match to d3f52a_
   complexed with act, mpd

Details for d3f51e1

PDB Entry: 3f51, 2.05 Å

PDB Description: crystal structure of the clp gene regulator clgr from corynebacterium glutamicum

PDB Compounds: (E:) clp gene regulator (ClgR)

SCOPe Domain Sequences for d3f51e1:

Sequence; same for both SEQRES and ATOM records:

>d3f51e1 a.35.1.0 (E:19-107) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
kapepllrealgaalrsfradkgvtlrelaeasrvspgylselergrkevssellasvch
algasvadvlieaagsmalqaaqedlarv

Timeline for d3f51e1:

• d3f51e1 is new in SCOPe 2.07-stable
  
• d3f51e1 appears in the current release, SCOPe 2.08