SCOPe 2.08: Domain d5nxja1: 5nxj A:5-61

Lineage for d5nxja1 (5nxj A:5-61)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)

8. Domain d5nxja1: 5nxj A:5-61 [352926]
   Other proteins in same PDB: d5nxja2, d5nxjb2, d5nxjc2, d5nxjd2, d5nxje2, d5nxjf2
   automated match to d2d1xb_
   complexed with ipa

Details for d5nxja1

PDB Entry: 5nxj, 2.28 Å

PDB Description: sh3 domain from mouse cortactin (p 1 21 1 crystal form)

PDB Compounds: (A:) Src substrate cortactin

SCOPe Domain Sequences for d5nxja1:

Sequence; same for both SEQRES and ATOM records:

>d5nxja1 b.34.2.0 (A:5-61) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

Timeline for d5nxja1:

• d5nxja1 first appeared in SCOPe 2.07