Lineage for d5nxje1 (5nxj E:5-61)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783623Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)
  8. 2783637Domain d5nxje1: 5nxj E:5-61 [352921]
    Other proteins in same PDB: d5nxja2, d5nxjb2, d5nxjc2, d5nxjd2, d5nxje2, d5nxjf2
    automated match to d2d1xb_
    complexed with ipa

Details for d5nxje1

PDB Entry: 5nxj (more details), 2.28 Å

PDB Description: sh3 domain from mouse cortactin (p 1 21 1 crystal form)
PDB Compounds: (E:) Src substrate cortactin

SCOPe Domain Sequences for d5nxje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nxje1 b.34.2.0 (E:5-61) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gitaialydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

SCOPe Domain Coordinates for d5nxje1:

Click to download the PDB-style file with coordinates for d5nxje1.
(The format of our PDB-style files is described here.)

Timeline for d5nxje1: