Lineage for d1fcjc_ (1fcj C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27517Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 27518Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 27519Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins)
  6. 27526Protein O-acetylserine sulfhydrylase (Cystein synthase) [53690] (1 species)
  7. 27527Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries)
  8. 27530Domain d1fcjc_: 1fcj C: [35291]

Details for d1fcjc_

PDB Entry: 1fcj (more details), 2 Å

PDB Description: crystal structure of oass complexed with chloride and sulfate

SCOP Domain Sequences for d1fcjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcjc_ c.79.1.1 (C:) O-acetylserine sulfhydrylase (Cystein synthase) {Salmonella typhimurium}
skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sger

SCOP Domain Coordinates for d1fcjc_:

Click to download the PDB-style file with coordinates for d1fcjc_.
(The format of our PDB-style files is described here.)

Timeline for d1fcjc_: