Lineage for d5nv2b_ (5nv2 B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. Protein DNA methyltransferase DNMT3B [69251] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [188834] (10 PDB entries)
  8. Domain d5nv2b_: 5nv2 B: [352908]
    automated match to d3qkjb_
    complexed with 9ae, so4

Details for d5nv2b_

PDB Entry: 5nv2 (more details), 2.03 Å

PDB Description: human dnmt3b pwwp domain in complex with n-isopropyl-1,5- dimethylhexylamine (metron s)
PDB Compounds: (B:) DNA (cytosine-5)-methyltransferase 3B

SCOPe Domain Sequences for d5nv2b_:

Sequence, based on SEQRES records: (download)

>d5nv2b_ b.34.9.2 (B:) DNA methyltransferase DNMT3B {Human (Homo sapiens) [TaxId: 9606]}
seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmle
wahggfkptgieglkpn

Sequence, based on observed residues (ATOM records): (download)

>d5nv2b_ b.34.9.2 (B:) DNA methyltransferase DNMT3B {Human (Homo sapiens) [TaxId: 9606]}
seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpssledqlkpmlewahg
gfkptgieglkpn

SCOPe Domain Coordinates for d5nv2b_ are not available.

Timeline for d5nv2b_:

Domains from other chains:
(mouse over for more information)
d5nv2a_