Lineage for d6cvmc1 (6cvm C:2-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384843Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries)
  8. 2384850Domain d6cvmc1: 6cvm C:2-219 [352903]
    Other proteins in same PDB: d6cvma2, d6cvma3, d6cvma4, d6cvma5, d6cvmb2, d6cvmb3, d6cvmb4, d6cvmb5, d6cvmc2, d6cvmc3, d6cvmc4, d6cvmc5, d6cvmd2, d6cvmd3, d6cvmd4, d6cvmd5
    automated match to d1f4ha3
    complexed with mg, na, ptq

Details for d6cvmc1

PDB Entry: 6cvm (more details), 1.9 Å

PDB Description: atomic resolution cryo-em structure of beta-galactosidase
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d6cvmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvmc1 b.18.1.0 (C:2-219) automated matches {Escherichia coli [TaxId: 83333]}
mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa
wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg
cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage
nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6cvmc1:

Click to download the PDB-style file with coordinates for d6cvmc1.
(The format of our PDB-style files is described here.)

Timeline for d6cvmc1: