![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (49 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
![]() | Domain d6cvmc1: 6cvm C:2-219 [352903] Other proteins in same PDB: d6cvma2, d6cvma3, d6cvma4, d6cvma5, d6cvmb2, d6cvmb3, d6cvmb4, d6cvmb5, d6cvmc2, d6cvmc3, d6cvmc4, d6cvmc5, d6cvmd2, d6cvmd3, d6cvmd4, d6cvmd5 automated match to d1f4ha3 complexed with mg, na, ptq |
PDB Entry: 6cvm (more details), 1.9 Å
SCOPe Domain Sequences for d6cvmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cvmc1 b.18.1.0 (C:2-219) automated matches {Escherichia coli [TaxId: 83333]} mitdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfa wfpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptg cysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflrage nrlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d6cvmc1:
![]() Domains from same chain: (mouse over for more information) d6cvmc2, d6cvmc3, d6cvmc4, d6cvmc5 |