SCOP 1.59: Domain d1fcjb_: 1fcj B:

Lineage for d1fcjb_ (1fcj B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)

6. Protein O-acetylserine sulfhydrylase (Cystein synthase) [53690] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries)

8. Domain d1fcjb_: 1fcj B: [35290]

Details for d1fcjb_

PDB Entry: 1fcj, 2 Å

PDB Description: crystal structure of oass complexed with chloride and sulfate

SCOP Domain Sequences for d1fcjb_:

Sequence; same for both SEQRES and ATOM records:

>d1fcjb_ c.79.1.1 (B:) O-acetylserine sulfhydrylase (Cystein synthase) {Salmonella typhimurium}
skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sger

Timeline for d1fcjb_:

• d1fcjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fcjb_ appears in SCOP 1.57
  
• d1fcjb_ appears in SCOP 1.61
  
• d1fcjb_ appears in the current release, SCOPe 2.08