SCOPe 2.08: Domain d6c97a2: 6c97 A:177-268

Lineage for d6c97a2 (6c97 A:177-268)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6c97a2: 6c97 A:177-268 [352890]
   Other proteins in same PDB: d6c97a1, d6c97b_, d6c97c1, d6c97d_
   automated match to d3frua1
   complexed with gol

Details for d6c97a2

PDB Entry: 6c97, 2 Å

PDB Description: crystal structure of fcrn at ph3

PDB Compounds: (A:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d6c97a2:

Sequence; same for both SEQRES and ATOM records:

>d6c97a2 b.1.1.0 (A:177-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvele

Timeline for d6c97a2:

• d6c97a2 first appeared in SCOPe 2.07