SCOPe 2.03: Domain d1fcja_: 1fcj A:

Lineage for d1fcja_ (1fcj A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)

7. Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries)

8. Domain d1fcja_: 1fcj A: [35289]
   complexed with cl, plp, so4

Details for d1fcja_

PDB Entry: 1fcj, 2 Å

PDB Description: crystal structure of oass complexed with chloride and sulfate

PDB Compounds: (A:) O-acetylserine sulfhydrylase

SCOPe Domain Sequences for d1fcja_:

Sequence; same for both SEQRES and ATOM records:

>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]}
skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp
gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk
gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt
ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl
klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps
sg

Timeline for d1fcja_:

• d1fcja_ first appeared (with stable ids) in SCOP 1.55
  
• d1fcja_ appears in SCOPe 2.02
  
• d1fcja_ appears in SCOPe 2.04
  
• d1fcja_ appears in the current release, SCOPe 2.08