Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins) |
Protein O-acetylserine sulfhydrylase (Cystein synthase) [53690] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [53691] (3 PDB entries) |
Domain d1fcja_: 1fcj A: [35289] |
PDB Entry: 1fcj (more details), 2 Å
SCOP Domain Sequences for d1fcja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystein synthase) {Salmonella typhimurium} skiyednsltightplvrlnrigngrilakvesrnpsfsvkcriganmiwdaekrgvlkp gvelveptngntgialayvaaargykltltmpetmsierrkllkalganlvltegakgmk gaiqkaeeivasdpqkylllqqfsnpanpeihekttgpeiwedtdgqvdvfisgvgtggt ltgvtryikgtkgktdlitvaveptdspviaqalageeikpgphkiqgigagfipgnldl klidkvvgitneeaistarrlmeeegilagissgaavaaalklqedesftnknivvilps sg
Timeline for d1fcja_: