SCOPe 2.08: Domain d6c97a1: 6c97 A:4-176

Lineage for d6c97a1 (6c97 A:4-176)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d6c97a1: 6c97 A:4-176 [352889]
   Other proteins in same PDB: d6c97a2, d6c97b_, d6c97c2, d6c97d_
   automated match to d3frua2
   complexed with gol

Details for d6c97a1

PDB Entry: 6c97, 2 Å

PDB Description: crystal structure of fcrn at ph3

PDB Compounds: (A:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d6c97a1:

Sequence; same for both SEQRES and ATOM records:

>d6c97a1 d.19.1.0 (A:4-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek
ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk
qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

Timeline for d6c97a1:

• d6c97a1 first appeared in SCOPe 2.07