Lineage for d6fgwa_ (6fgw A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708274Domain d6fgwa_: 6fgw A: [352868]
    automated match to d4lz2a_
    complexed with d9q

Details for d6fgwa_

PDB Entry: 6fgw (more details), 2.73 Å

PDB Description: crystal structure of baz2a bromodomain in complex with 1- methylpyridinone compound 4
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2A

SCOPe Domain Sequences for d6fgwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fgwa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggytss
eefaadallvfdncqtfneddsevgkaghimrrffesrweefy

SCOPe Domain Coordinates for d6fgwa_:

Click to download the PDB-style file with coordinates for d6fgwa_.
(The format of our PDB-style files is described here.)

Timeline for d6fgwa_: