Lineage for d6d8bd_ (6d8b D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2592030Protein automated matches [254646] (30 species)
    not a true protein
  7. 2592219Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3052804Domain d6d8bd_: 6d8b D: [352866]
    Other proteins in same PDB: d6d8ba_, d6d8bc_, d6d8be_
    automated match to d4d00d_
    complexed with nag

Details for d6d8bd_

PDB Entry: 6d8b (more details), 2.95 Å

PDB Description: the crystal structure of hemagglutinin from a/hong kong/125/2017 h7n9 influenza virus
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6d8bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d8bd_ h.3.1.1 (D:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
qqfelidnefnevekqignvinwtrdsitevwsynaelliamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnri

SCOPe Domain Coordinates for d6d8bd_:

Click to download the PDB-style file with coordinates for d6d8bd_.
(The format of our PDB-style files is described here.)

Timeline for d6d8bd_:

  • d6d8bd_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-31