Lineage for d5npqb1 (5npq B:115-295)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (48 species)
    not a true protein
  7. 2533846Species Human (Homo sapiens) [TaxId:9606] [225745] (54 PDB entries)
  8. 3052802Domain d5npqb1: 5npq B:115-295 [352864]
    automated match to d3iu1a1
    complexed with 94q, gol, mg

Details for d5npqb1

PDB Entry: 5npq (more details), 2.37 Å

PDB Description: human n-myristoyltransferase 1 (mnt1) with myristoyl-coa analogue x10 bound
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d5npqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5npqb1 d.108.1.0 (B:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
r

SCOPe Domain Coordinates for d5npqb1:

Click to download the PDB-style file with coordinates for d5npqb1.
(The format of our PDB-style files is described here.)

Timeline for d5npqb1:

  • d5npqb1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d5npqb2