Lineage for d6giia_ (6gii A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. Protein automated matches [190847] (97 species)
    not a true protein
  7. Species Tepidiphilus thermophilus [TaxId:876478] [352859] (2 PDB entries)
  8. Domain d6giia_: 6gii A: [352860]
    automated match to d1q5ea_
    complexed with hem

Details for d6giia_

PDB Entry: 6gii (more details), 1.9 Å

PDB Description: the crystal structure of tepidiphilus thermophilus p450 heme domain
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d6giia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6giia_ a.104.1.0 (A:) automated matches {Tepidiphilus thermophilus [TaxId: 876478]}
vhrlaedfdpfqdaymadpaqfvrwareqvpifyapklnywvvtrydtikqifrdpvtfs
psnvlqsfaqpsaevrqvlerygyafnrtlvnedepmhlerrrvlmepfasehlaehepm
vrelvrravnrfidtgradlvdqmiwevpftvalhflgvddddrekmrrfaiahtvnafg
rpspeeqlavaetvgqfwqfcgevlekmrrtadgpgwmrysirqqklypdvvtdsylhsm
mqaiivaahettvfattnalktllehetvwreicadpslipaaaeeclryngpvagwrrr
ttrevevegvrlpvganilmvvasanhdsahfddpeffdigrsnasehlnfgygahqclg
rnlgrmemqimieelsrrlphmrlaeqrfdylhnvsfraprhlwvewdpaqnperr

SCOPe Domain Coordinates for d6giia_ are not available.

Timeline for d6giia_: