Lineage for d6d7ub_ (6d7u B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2592334Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2592335Protein automated matches [254645] (35 species)
    not a true protein
  7. 2592429Species Influenza A virus [TaxId:1332244] [327811] (5 PDB entries)
  8. 3052785Domain d6d7ub_: 6d7u B: [352847]
    Other proteins in same PDB: d6d7ua_, d6d7uc_, d6d7ue_
    automated match to d5t6sb_
    complexed with nag

Details for d6d7ub_

PDB Entry: 6d7u (more details), 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/guangdong/17sf003/2016 h7n9 influenza virus
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6d7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d7ub_ h.3.1.0 (B:) automated matches {Influenza A virus [TaxId: 1332244]}
gifgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliaktn
qqfklidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhrkyreeamqnri

SCOPe Domain Coordinates for d6d7ub_:

Click to download the PDB-style file with coordinates for d6d7ub_.
(The format of our PDB-style files is described here.)

Timeline for d6d7ub_: