Lineage for d6fgfa_ (6fgf A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. Protein automated matches [190615] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1029 PDB entries)
  8. Domain d6fgfa_: 6fgf A: [352844]
    automated match to d4lz2a_
    complexed with en2

Details for d6fgfa_

PDB Entry: 6fgf (more details), 2.8 Å

PDB Description: crystal structure of baz2a bromodomain in complex with 1- methylpyridinone compound 2
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2A

SCOPe Domain Sequences for d6fgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fgfa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrerllrggytss
eefaadallvfdncqtfneddsevgkaghimrrffesrweefy

SCOPe Domain Coordinates for d6fgfa_ are not available.

Timeline for d6fgfa_: