SCOPe 2.07: Domain d6fjfb2: 6fjf B:246-438

Lineage for d6fjfb2 (6fjf B:246-438)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)

8. Domain d6fjfb2: 6fjf B:246-438 [352842]
   Other proteins in same PDB: d6fjfb1, d6fjfc1, d6fjfd1, d6fjfe_, d6fjff1, d6fjff2, d6fjff3
   automated match to d3rycd2
   complexed with acp, ca, dke, dms, gdp, gtp, mes, mg, peg

Details for d6fjfb2

PDB Entry: 6fjf, 2.4 Å

PDB Description: tubulin-fcmaytansine complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6fjfb2:

Sequence, based on SEQRES records:

>d6fjfb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Sequence, based on observed residues (ATOM records):

>d6fjfb2 d.79.2.1 (B:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh
gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
a

Timeline for d6fjfb2:

• d6fjfb2 is new in SCOPe 2.07-stable
  
• d6fjfb2 appears in the current release, SCOPe 2.08