Lineage for d2tsyb_ (2tsy B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins) Protein Tryptophan synthase, beta-subunit [53688] (1 species) Species Salmonella typhimurium [TaxId:90371] [53689] (21 PDB entries) 
Domain d2tsyb_: 2tsy B: [35283]
Other proteins in same PDB: d2tsya_
Details for d2tsyb_
PDB Entry: 2tsy (more details), 2.5 Å
PDB Description: crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes
SCOP Domain Sequences for d2tsyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tsyb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil
SCOP Domain Coordinates for d2tsyb_:
Click to download the PDB-style file with coordinates for d2tsyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tsyb_:
- d2tsyb_ appears in SCOP 1.57
- d2tsyb_ appears in the current release, SCOPe 2.08
View in 3D
