Lineage for d6dega2 (6deg A:125-251)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977231Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2977232Protein automated matches [226907] (28 species)
    not a true protein
  7. 2977291Species Bartonella birtlesii [TaxId:1094552] [352802] (1 PDB entry)
  8. 2977293Domain d6dega2: 6deg A:125-251 [352820]
    Other proteins in same PDB: d6dega4, d6degb4
    automated match to d6amsa2

Details for d6dega2

PDB Entry: 6deg (more details), 2.45 Å

PDB Description: crystal structure of a dna polymerase iii subunit beta dnan sliding clamp from bartonella birtlesii ll-wm9
PDB Compounds: (A:) Beta sliding clamp

SCOPe Domain Sequences for d6dega2:

Sequence, based on SEQRES records: (download)

>d6dega2 d.131.1.0 (A:125-251) automated matches {Bartonella birtlesii [TaxId: 1094552]}
qfgcrfflsasklkhlldctqfaisteetryylngiyfhivhddvlklrlvatdghrlaq
vdmeapsgvdgmpgviiprkavgelqkllseeidgdvcielsetkirfslgsvvftsklv
dgtfpdy

Sequence, based on observed residues (ATOM records): (download)

>d6dega2 d.131.1.0 (A:125-251) automated matches {Bartonella birtlesii [TaxId: 1094552]}
qfgcrfflsasklkhlldctqfangiyfhivhddvlklrlvatdghrlaqvdmeapsgvd
gmpgviiprkavgelqkllseeidgdvcielsetkirfslgsvvftsklvdgtfpdy

SCOPe Domain Coordinates for d6dega2:

Click to download the PDB-style file with coordinates for d6dega2.
(The format of our PDB-style files is described here.)

Timeline for d6dega2: