Lineage for d1c8vb_ (1c8v B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591978Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 591979Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 591980Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)
  6. 592114Protein Tryptophan synthase, beta-subunit [53688] (1 species)
  7. 592115Species Salmonella typhimurium [TaxId:90371] [53689] (33 PDB entries)
  8. 592141Domain d1c8vb_: 1c8v B: [35282]
    Other proteins in same PDB: d1c8va_

Details for d1c8vb_

PDB Entry: 1c8v (more details), 2.2 Å

PDB Description: crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxyphenylthio)-butylphosphonic acid

SCOP Domain Sequences for d1c8vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8vb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhd

SCOP Domain Coordinates for d1c8vb_:

Click to download the PDB-style file with coordinates for d1c8vb_.
(The format of our PDB-style files is described here.)

Timeline for d1c8vb_: