Lineage for d1a50b_ (1a50 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74602Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 74603Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 74604Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 74636Protein Tryptophan synthase, beta-subunit [53688] (1 species)
  7. 74637Species Salmonella typhimurium [TaxId:90371] [53689] (21 PDB entries)
  8. 74649Domain d1a50b_: 1a50 B: [35280]
    Other proteins in same PDB: d1a50a_

Details for d1a50b_

PDB Entry: 1a50 (more details), 2.3 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with 5-fluoroindole propanol phosphate

SCOP Domain Sequences for d1a50b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a50b_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
ttllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdil

SCOP Domain Coordinates for d1a50b_:

Click to download the PDB-style file with coordinates for d1a50b_.
(The format of our PDB-style files is described here.)

Timeline for d1a50b_: