Lineage for d6ejmi2 (6ejm I:175-286)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760352Domain d6ejmi2: 6ejm I:175-286 [352799]
    Other proteins in same PDB: d6ejma1, d6ejma2, d6ejmb1, d6ejmb2
    automated match to d4v1db_

Details for d6ejmi2

PDB Entry: 6ejm (more details), 2.15 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 5
PDB Compounds: (I:) single chain fv fragment

SCOPe Domain Sequences for d6ejmi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ejmi2 b.1.1.0 (I:175-286) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpltlsvtigqpasisckssqslfdtdgktyltwllqrpgqspkrliylvskla
sgvpdrftgsgsgtdftlkisrveaedlgvyyclqgthfpltfgagtkldlk

SCOPe Domain Coordinates for d6ejmi2:

Click to download the PDB-style file with coordinates for d6ejmi2.
(The format of our PDB-style files is described here.)

Timeline for d6ejmi2: