SCOPe 2.08: Domain d6ejmi1: 6ejm I:40-154

Lineage for d6ejmi1 (6ejm I:40-154)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d6ejmi1: 6ejm I:40-154 [352798]
   Other proteins in same PDB: d6ejma1, d6ejma2, d6ejmb1, d6ejmb2
   automated match to d4v1db_

Details for d6ejmi1

PDB Entry: 6ejm, 2.15 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 5

PDB Compounds: (I:) single chain fv fragment

SCOPe Domain Sequences for d6ejmi1:

Sequence; same for both SEQRES and ATOM records:

>d6ejmi1 b.1.1.0 (I:40-154) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vmlvesgggfvkpggslklscaasgftfrsyimswvrqtpekrlewvatisggggntyyp
dsvkgrftisrdnakntlylqlsslrsedtalyycasltavgdywgqgtsvtvss

Timeline for d6ejmi1:

• d6ejmi1 first appeared in SCOPe 2.07