SCOPe 2.08: Domain d6ejga1: 6ejg A:113-200

Lineage for d6ejga1 (6ejg A:113-200)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.135: Tetraspanin [48651] (1 superfamily)
   5 helices: irregular disulfide-linked array; form homodimer

4. Superfamily a.135.1: Tetraspanin [48652] (1 family)

5. Family a.135.1.1: Tetraspanin [48653] (2 proteins)

6. Protein automated matches [256548] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256549] (15 PDB entries)

8. Domain d6ejga1: 6ejg A:113-200 [352793]
   Other proteins in same PDB: d6ejga2, d6ejgb2, d6ejgc1, d6ejgc2, d6ejgd1, d6ejgd2
   automated match to d3x0ga_

Details for d6ejga1

PDB Entry: 6ejg, 2.82 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment 4

PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d6ejga1:

Sequence; same for both SEQRES and ATOM records:

>d6ejga1 a.135.1.1 (A:113-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlkn
nlcpsgsniisnlfkedchqkiddlfsg

Timeline for d6ejga1:

• d6ejga1 first appeared in SCOPe 2.07