Lineage for d1fuyb_ (1fuy B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 844422Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 844423Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 844424Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 844592Protein Tryptophan synthase, beta-subunit [53688] (2 species)
  7. 844604Species Salmonella typhimurium [TaxId:90371] [53689] (47 PDB entries)
  8. 844639Domain d1fuyb_: 1fuy B: [35279]
    Other proteins in same PDB: d1fuya_
    complexed with fip, na, plp; mutant

Details for d1fuyb_

PDB Entry: 1fuy (more details), 2.25 Å

PDB Description: crystal structure of betaa169l/betac170w double mutant of tryptophan synthase complexed with 5-fluoro-indole-propanol phosphate
PDB Compounds: (B:) tryptophan synthase beta chain

SCOP Domain Sequences for d1fuyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuyb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdlwnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkar

SCOP Domain Coordinates for d1fuyb_:

Click to download the PDB-style file with coordinates for d1fuyb_.
(The format of our PDB-style files is described here.)

Timeline for d1fuyb_: