Lineage for d6fh6a1 (6fh6 A:1858-1970)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1051 PDB entries)
  8. 2708129Domain d6fh6a1: 6fh6 A:1858-1970 [352774]
    Other proteins in same PDB: d6fh6a2
    automated match to d3uv2a_
    complexed with d8q

Details for d6fh6a1

PDB Entry: 6fh6 (more details), 2.08 Å

PDB Description: crystal structure of baz2b bromodomain in complex with 1- methylpyridinone compound 1
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d6fh6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fh6a1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk

SCOPe Domain Coordinates for d6fh6a1:

Click to download the PDB-style file with coordinates for d6fh6a1.
(The format of our PDB-style files is described here.)

Timeline for d6fh6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fh6a2