SCOP 1.75: Domain d2trsb_: 2trs B:

Lineage for d2trsb_ (2trs B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (47 PDB entries)

8. Domain d2trsb_: 2trs B: [35277]
   Other proteins in same PDB: d2trsa_
   complexed with ipl, na, pls; mutant

Details for d2trsb_

PDB Entry: 2trs, 2.04 Å

PDB Description: crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes

PDB Compounds: (B:) tryptophan synthase

SCOP Domain Sequences for d2trsb_:

Sequence; same for both SEQRES and ATOM records:

>d2trsb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d2trsb_:

• d2trsb_ first appeared (with stable ids) in SCOP 1.55
  
• d2trsb_ appears in SCOP 1.73
  
• d2trsb_ appears in SCOPe 2.01
  
• d2trsb_ appears in the current release, SCOPe 2.08