Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Aeromonas enteropelogenes [TaxId:29489] [352762] (2 PDB entries) |
Domain d6fm7a_: 6fm7 A: [352763] automated match to d5chua_ complexed with edo, nxl, so4 |
PDB Entry: 6fm7 (more details), 1.04 Å
SCOPe Domain Sequences for d6fm7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fm7a_ e.3.1.0 (A:) automated matches {Aeromonas enteropelogenes [TaxId: 29489]} epmanivekavqplleeyripgmavavlkegkphyfnygvanresgrrisertlfeigsv sktftatlgtyavvkggfrlddkvsqhapwlqnsafdrvtmaqlatysagglplqfpdav dsnermrqyyrqwsplyaagthreysnpsiglfghlaastlgqpfrqlmsqtllpkldlq htylevpdaamvdyaygyskedkpvrvnpgvladeaygiktsaadlikfvganmtgsgdk avqqalamtrtgfysvgemtqglgwesyaypvteqallagnspavsfkanpvkpfvaprv mgnerlynktgstngfgayvvfvpargvgivmlanrnypiearvkaayaimrhlap
Timeline for d6fm7a_: