Lineage for d6fm7a_ (6fm7 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014283Species Aeromonas enteropelogenes [TaxId:29489] [352762] (2 PDB entries)
  8. 3014284Domain d6fm7a_: 6fm7 A: [352763]
    automated match to d5chua_
    complexed with edo, nxl, so4

Details for d6fm7a_

PDB Entry: 6fm7 (more details), 1.04 Å

PDB Description: crystal structure of the class c beta-lactamase tru-1 from aeromonas enteropelogenes in complex with avibactam
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6fm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fm7a_ e.3.1.0 (A:) automated matches {Aeromonas enteropelogenes [TaxId: 29489]}
epmanivekavqplleeyripgmavavlkegkphyfnygvanresgrrisertlfeigsv
sktftatlgtyavvkggfrlddkvsqhapwlqnsafdrvtmaqlatysagglplqfpdav
dsnermrqyyrqwsplyaagthreysnpsiglfghlaastlgqpfrqlmsqtllpkldlq
htylevpdaamvdyaygyskedkpvrvnpgvladeaygiktsaadlikfvganmtgsgdk
avqqalamtrtgfysvgemtqglgwesyaypvteqallagnspavsfkanpvkpfvaprv
mgnerlynktgstngfgayvvfvpargvgivmlanrnypiearvkaayaimrhlap

SCOPe Domain Coordinates for d6fm7a_:

Click to download the PDB-style file with coordinates for d6fm7a_.
(The format of our PDB-style files is described here.)

Timeline for d6fm7a_: