Lineage for d6b20b_ (6b20 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2399102Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2399257Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2399258Family b.69.4.1: WD40-repeat [50979] (17 proteins)
  6. 2399383Protein automated matches [190346] (4 species)
    not a true protein
  7. 2399384Species Cow (Bos taurus) [TaxId:9913] [187173] (15 PDB entries)
  8. 3052689Domain d6b20b_: 6b20 B: [352751]
    Other proteins in same PDB: d6b20c_, d6b20d_, d6b20e_, d6b20f_
    automated match to d3v5wb_
    complexed with cl, unx

Details for d6b20b_

PDB Entry: 6b20 (more details), 2.34 Å

PDB Description: crystal structure of a complex between g protein beta gamma dimer and an inhibitory nanobody regulator
PDB Compounds: (B:) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

SCOPe Domain Sequences for d6b20b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b20b_ b.69.4.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eldqlrqeaeqlknqirdarkacadatlsqitnnidpvgriqmrtrrtlrghlakiyamh
wgtdsrlllsasqdgkliiwdsyttnkvhaiplrsswvmtcayapsgnyvacggldnics
iynlktregnvrvsrelaghtgylsccrflddnqivtssgdttcalwdietgqqtttftg
htgdvmslslapdtrlfvsgacdasaklwdvregmcrqtftghesdinaicffpngnafa
tgsddatcrlfdlradqelmtyshdniicgitsvsfsksgrlllagyddfncnvwdalka
dragvlaghdnrvsclgvtddgmavatgswdsflkiwn

SCOPe Domain Coordinates for d6b20b_:

Click to download the PDB-style file with coordinates for d6b20b_.
(The format of our PDB-style files is described here.)

Timeline for d6b20b_:

  • d6b20b_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-31