SCOP 1.73: Domain d1a5bb_: 1a5b B:

Lineage for d1a5bb_ (1a5b B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (42 PDB entries)

8. Domain d1a5bb_: 1a5b B: [35275]
   Other proteins in same PDB: d1a5ba_
   complexed with igp, k, plp; mutant

Details for d1a5bb_

PDB Entry: 1a5b, 2 Å

PDB Description: cryo-crystallography of a true substrate, indole-3-glycerol phosphate, bound to a mutant (alpha d60n) tryptophan synthase alpha2beta2 complex reveals the correct orientation of active site alpha glu 49

PDB Compounds: (B:) tryptophan synthase (beta chain)

SCOP Domain Sequences for d1a5bb_:

Sequence; same for both SEQRES and ATOM records:

>d1a5bb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 602]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d1a5bb_:

• d1a5bb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a5bb_ appears in SCOP 1.71
  
• d1a5bb_ appears in SCOP 1.75
  
• d1a5bb_ appears in the current release, SCOPe 2.08