Lineage for d6fjmd1 (6fjm D:2-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445289Species Cow (Bos taurus) [TaxId:9913] [226564] (60 PDB entries)
  8. 3052687Domain d6fjmd1: 6fjm D:2-245 [352749]
    Other proteins in same PDB: d6fjma2, d6fjmb2, d6fjmc2, d6fjmd2, d6fjme_, d6fjmf1, d6fjmf2, d6fjmf3
    automated match to d4drxb1
    complexed with acp, ca, dkn, gdp, gtp, mes, mg

Details for d6fjmd1

PDB Entry: 6fjm (more details), 2.1 Å

PDB Description: tubulin-disorazole z complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6fjmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fjmd1 c.32.1.1 (D:2-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d6fjmd1:

Click to download the PDB-style file with coordinates for d6fjmd1.
(The format of our PDB-style files is described here.)

Timeline for d6fjmd1:

  • d6fjmd1 appears in periodic updates to SCOPe 2.07 starting on 2018-05-31