SCOP 1.71: Domain d1ubsb_: 1ubs B:

Lineage for d1ubsb_ (1ubs B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (33 PDB entries)

8. Domain d1ubsb_: 1ubs B: [35273]
   Other proteins in same PDB: d1ubsa_
   complexed with na, plp; mutant

Details for d1ubsb_

PDB Entry: 1ubs, 1.9 Å

PDB Description: tryptophan synthase (e.c.4.2.1.20) with a mutation of lys 87->thr in the b subunit and in the presence of ligand l-serine

SCOP Domain Sequences for d1ubsb_:

Sequence; same for both SEQRES and ATOM records:

>d1ubsb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil

Timeline for d1ubsb_:

• d1ubsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ubsb_ appears in SCOP 1.69
  
• d1ubsb_ appears in SCOP 1.73
  
• d1ubsb_ appears in the current release, SCOPe 2.08