Lineage for d1ubsb_ (1ubs B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139947Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2139970Species Salmonella typhimurium [TaxId:90371] [53689] (44 PDB entries)
  8. 2139986Domain d1ubsb_: 1ubs B: [35273]
    Other proteins in same PDB: d1ubsa_
    complexed with na, plp, ser; mutant

Details for d1ubsb_

PDB Entry: 1ubs (more details), 1.9 Å

PDB Description: tryptophan synthase (e.c.4.2.1.20) with a mutation of lys 87->thr in the b subunit and in the presence of ligand l-serine
PDB Compounds: (B:) tryptophan synthase

SCOPe Domain Sequences for d1ubsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubsb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil

SCOPe Domain Coordinates for d1ubsb_:

Click to download the PDB-style file with coordinates for d1ubsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ubsb_: