SCOP 1.75: Domain d2tysb_: 2tys B:

Lineage for d2tysb_ (2tys B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (47 PDB entries)

8. Domain d2tysb_: 2tys B: [35272]
   Other proteins in same PDB: d2tysa_
   complexed with na, plt; mutant

Details for d2tysb_

PDB Entry: 2tys, 1.9 Å

PDB Description: crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes

PDB Compounds: (B:) tryptophan synthase

SCOP Domain Sequences for d2tysb_:

Sequence; same for both SEQRES and ATOM records:

>d2tysb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdilkargei

Timeline for d2tysb_:

• d2tysb_ first appeared (with stable ids) in SCOP 1.55
  
• d2tysb_ appears in SCOP 1.73
  
• d2tysb_ appears in SCOPe 2.01
  
• d2tysb_ appears in the current release, SCOPe 2.08