Lineage for d2tysb_ (2tys B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127373Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
  4. 127374Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 127375Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 127407Protein Tryptophan synthase, beta-subunit [53688] (1 species)
  7. 127408Species Salmonella typhimurium [TaxId:90371] [53689] (21 PDB entries)
  8. 127411Domain d2tysb_: 2tys B: [35272]
    Other proteins in same PDB: d2tysa_

Details for d2tysb_

PDB Entry: 2tys (more details), 1.9 Å

PDB Description: crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes

SCOP Domain Sequences for d2tysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tysb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahttnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdilkargei

SCOP Domain Coordinates for d2tysb_:

Click to download the PDB-style file with coordinates for d2tysb_.
(The format of our PDB-style files is described here.)

Timeline for d2tysb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2tysa_