![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein cAMP-dependent PK, catalytic subunit [56116] (7 species) AGC group; PKA subfamily; serine/threonine kinase |
![]() | Species Homo sapiens [TaxId:9606] [352703] (2 PDB entries) |
![]() | Domain d6c0ua_: 6c0u A: [352704] automated match to d1smha_ complexed with dms, ee4, po4 |
PDB Entry: 6c0u (more details), 2.65 Å
SCOPe Domain Sequences for d6c0ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c0ua_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Homo sapiens [TaxId: 9606]} eqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhya mkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfs hlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakr vkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyeki vsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkv eapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d6c0ua_: