Lineage for d6c0ua_ (6c0u A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586596Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2586675Species Homo sapiens [TaxId:9606] [352703] (2 PDB entries)
  8. 2586677Domain d6c0ua_: 6c0u A: [352704]
    automated match to d1smha_
    complexed with dms, ee4, po4

Details for d6c0ua_

PDB Entry: 6c0u (more details), 2.65 Å

PDB Description: crystal structure of camp-dependent protein kinase calpha subunit bound with n46
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d6c0ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c0ua_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Homo sapiens [TaxId: 9606]}
eqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhya
mkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfs
hlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakr
vkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyeki
vsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkv
eapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d6c0ua_:

Click to download the PDB-style file with coordinates for d6c0ua_.
(The format of our PDB-style files is described here.)

Timeline for d6c0ua_: