Lineage for d6b20d_ (6b20 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2339505Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2339610Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
    automatically mapped to Pfam PF00631
  5. 2339611Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)
  6. 2339646Protein automated matches [320489] (1 species)
    not a true protein
  7. 2339647Species Cow (Bos taurus) [TaxId:9913] [320490] (3 PDB entries)
  8. 3052636Domain d6b20d_: 6b20 D: [352698]
    Other proteins in same PDB: d6b20a_, d6b20b_, d6b20e_, d6b20f_
    automated match to d1tbge_
    complexed with cl, unx

Details for d6b20d_

PDB Entry: 6b20 (more details), 2.34 Å

PDB Description: crystal structure of a complex between g protein beta gamma dimer and an inhibitory nanobody regulator
PDB Compounds: (D:) Guanine nucleotide-binding protein G(T) subunit gamma-T1

SCOPe Domain Sequences for d6b20d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b20d_ a.137.3.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
edltekdklkmevdqlkkevtlermlvskcceefrdyveersgedplvkgipedknpfk

SCOPe Domain Coordinates for d6b20d_:

Click to download the PDB-style file with coordinates for d6b20d_.
(The format of our PDB-style files is described here.)

Timeline for d6b20d_:

  • d6b20d_ is new in SCOPe 2.07-stable