Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [352469] (2 PDB entries) |
Domain d6fpec1: 6fpe C:1-103 [352694] Other proteins in same PDB: d6fpea2, d6fpec2 automated match to d2a6aa1 protein/RNA complex; complexed with apc, gol, mg, peg |
PDB Entry: 6fpe (more details), 3.14 Å
SCOPe Domain Sequences for d6fpec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fpec1 c.55.1.0 (C:1-103) automated matches {Thermotoga maritima [TaxId: 243274]} mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv gigpggltglrvgiatvvglvspydipvaplnsfemtakscpa
Timeline for d6fpec1: