Lineage for d6fpec1 (6fpe C:1-103)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493481Species Thermotoga maritima [TaxId:243274] [352469] (2 PDB entries)
  8. 2493485Domain d6fpec1: 6fpe C:1-103 [352694]
    Other proteins in same PDB: d6fpea2, d6fpec2
    automated match to d2a6aa1
    protein/RNA complex; complexed with apc, gol, mg, peg

Details for d6fpec1

PDB Entry: 6fpe (more details), 3.14 Å

PDB Description: bacterial protein complex
PDB Compounds: (C:) tRNA threonylcarbamoyladenosine biosynthesis protein tsab

SCOPe Domain Sequences for d6fpec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fpec1 c.55.1.0 (C:1-103) automated matches {Thermotoga maritima [TaxId: 243274]}
mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv
gigpggltglrvgiatvvglvspydipvaplnsfemtakscpa

SCOPe Domain Coordinates for d6fpec1:

Click to download the PDB-style file with coordinates for d6fpec1.
(The format of our PDB-style files is described here.)

Timeline for d6fpec1:

  • d6fpec1 is new in SCOPe 2.07-stable
  • d6fpec1 does not appear in SCOPe 2.08

View in 3D
Domains from same chain:
(mouse over for more information)
d6fpec2