Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein beta-Lactoglobulin [50827] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [50828] (77 PDB entries) Uniprot P02754 |
Domain d6fxba_: 6fxb A: [352693] automated match to d1bsoa_ complexed with no3, peg |
PDB Entry: 6fxb (more details), 2 Å
SCOPe Domain Sequences for d6fxba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fxba_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
Timeline for d6fxba_: