Lineage for d1ttpb_ (1ttp B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (4 proteins) Protein Tryptophan synthase, beta-subunit [53688] (1 species) Species Salmonella typhimurium [TaxId:90371] [53689] (21 PDB entries) 
Domain d1ttpb_: 1ttp B: [35269]
Other proteins in same PDB: d1ttpa_
Details for d1ttpb_
PDB Entry: 1ttp (more details), 2.3 Å
PDB Description: tryptophan synthase (e.c.4.2.1.20) in the presence of cesium, room temperature
SCOP Domain Sequences for d1ttpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ttpb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdil
SCOP Domain Coordinates for d1ttpb_:
Click to download the PDB-style file with coordinates for d1ttpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ttpb_:
- d1ttpb_ appears in SCOP 1.57
- d1ttpb_ appears in the current release, SCOPe 2.08
View in 3D
