| Class b: All beta proteins [48724] (178 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
| Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
| Species Achromobacter cycloclastes [TaxId:223] [49552] (60 PDB entries) |
| Domain d5ofha2: 5ofh A:167-339 [352671] automated match to d2bw4a2 complexed with act, cu, no2 |
PDB Entry: 5ofh (more details), 1.58 Å
SCOPe Domain Sequences for d5ofha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ofha2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpas
Timeline for d5ofha2: