Lineage for d5ofha2 (5ofh A:167-339)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381276Species Achromobacter cycloclastes [TaxId:223] [49552] (60 PDB entries)
  8. 2381351Domain d5ofha2: 5ofh A:167-339 [352671]
    automated match to d2bw4a2
    complexed with act, cu, no2

Details for d5ofha2

PDB Entry: 5ofh (more details), 1.58 Å

PDB Description: cu nitrite reductase serial data at varying temperatures rt 0.15mgy
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5ofha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ofha2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpas

SCOPe Domain Coordinates for d5ofha2:

Click to download the PDB-style file with coordinates for d5ofha2.
(The format of our PDB-style files is described here.)

Timeline for d5ofha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ofha1