Lineage for d1b73a2 (1b73 A:106-252)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.78: ATC-like [53670] (2 superfamilies)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) 
Family c.78.2.1: Aspartate/glutamate racemase [53682] (2 proteins)
C-terminal extension is added to the N-terminal domain
Protein Glutamate racemase [53683] (1 species) Species Aquifex pyrophilus [TaxId:2714] [53684] (2 PDB entries) 
Domain d1b73a2: 1b73 A:106-252 [35267]
Details for d1b73a2
PDB Entry: 1b73 (more details), 2.3 Å
PDB Description: glutamate racemase from aquifex pyrophilus
PDB Compounds: (A:) glutamate racemaseSCOPe Domain Sequences for d1b73a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b73a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]}
nkkigvigtpatvksgayqrkleeggadvfakacplfaplaeegllegeitrkvvehylk
efkgkidtlilgcthypllkkeikkflgdaevvdssealslslhnfikddgssslelfft
dlspnlqfliklilgrdypvklaegvf
SCOPe Domain Coordinates for d1b73a2:
Click to download the PDB-style file with coordinates for d1b73a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b73a2:
- d1b73a2 first appeared (with stable ids) in SCOP 1.55
- d1b73a2 appears in SCOPe 2.07
View in 3D
