![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
![]() | Protein automated matches [226871] (19 species) not a true protein |
![]() | Species Ulva prolifera [TaxId:3117] [352647] (1 PDB entry) |
![]() | Domain d5ylyb2: 5yly B:721-863 [352667] Other proteins in same PDB: d5ylya1, d5ylyb1 automated match to d1umka2 complexed with fad |
PDB Entry: 5yly (more details), 1.76 Å
SCOPe Domain Sequences for d5ylyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ylyb2 c.25.1.0 (B:721-863) automated matches {Ulva prolifera [TaxId: 3117]} pghyknhklesevkrinmiaggtgltpmyqvmkailsnpsdlteirllyanqteadillr pelealakshpdrvkihytvdrptpgwkyssgfidldmceralfryepgtisvlcgpppm lkfachpnlekmgfekgvtsief
Timeline for d5ylyb2: