Lineage for d5ylyb1 (5yly B:595-720)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793672Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2793673Protein automated matches [226870] (22 species)
    not a true protein
  7. 2793804Species Ulva prolifera [TaxId:3117] [352645] (1 PDB entry)
  8. 2793806Domain d5ylyb1: 5yly B:595-720 [352666]
    Other proteins in same PDB: d5ylya2, d5ylyb2
    automated match to d1umka1
    complexed with fad

Details for d5ylyb1

PDB Entry: 5yly (more details), 1.76 Å

PDB Description: crystal structure of the cytochrome b5 reductase domain of ulva prolifera nitrate reductase
PDB Compounds: (B:) nitrate reductase

SCOPe Domain Sequences for d5ylyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ylyb1 b.43.4.0 (B:595-720) automated matches {Ulva prolifera [TaxId: 3117]}
dapflnpkkqkaaelkekikishdvtlfrfglehdeqllglptgkhmlirkkvtnaegde
evvmraytpttanetrghfdlvvkiykanvhpkfpeggkfsqilealevgdtvevkgpig
hfhydr

SCOPe Domain Coordinates for d5ylyb1:

Click to download the PDB-style file with coordinates for d5ylyb1.
(The format of our PDB-style files is described here.)

Timeline for d5ylyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ylyb2