SCOPe 2.08: Domain d5ylyb1: 5yly B:595-720

Lineage for d5ylyb1 (5yly B:595-720)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (22 species)
   not a true protein

7. Species Ulva prolifera [TaxId:3117] [352645] (1 PDB entry)

8. Domain d5ylyb1: 5yly B:595-720 [352666]
   Other proteins in same PDB: d5ylya2, d5ylyb2
   automated match to d1umka1
   complexed with fad

Details for d5ylyb1

PDB Entry: 5yly, 1.76 Å

PDB Description: crystal structure of the cytochrome b5 reductase domain of ulva prolifera nitrate reductase

PDB Compounds: (B:) nitrate reductase

SCOPe Domain Sequences for d5ylyb1:

Sequence; same for both SEQRES and ATOM records:

>d5ylyb1 b.43.4.0 (B:595-720) automated matches {Ulva prolifera [TaxId: 3117]}
dapflnpkkqkaaelkekikishdvtlfrfglehdeqllglptgkhmlirkkvtnaegde
evvmraytpttanetrghfdlvvkiykanvhpkfpeggkfsqilealevgdtvevkgpig
hfhydr

Timeline for d5ylyb1:

• d5ylyb1 first appeared in SCOPe 2.07