Lineage for d5ocia_ (5oci A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (13 species)
    not a true protein
  7. 2537333Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries)
  8. 3052603Domain d5ocia_: 5oci A: [352665]
    automated match to d2xjxa_
    complexed with 9r8

Details for d5ocia_

PDB Entry: 5oci (more details), 1.62 Å

PDB Description: human heat shock protein 90 bound to 6-hydroxy-3-(3-methyl-benzyl)-1h- indazole-5-carboxylic acid methyl-(4-morpholin-4-yl-phenyl)-amide
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5ocia_:

Sequence, based on SEQRES records: (download)

>d5ocia_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

Sequence, based on observed residues (ATOM records): (download)

>d5ocia_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlnliaksgtkafmealqagadismigqfgvgfys
aylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqteylee
rrikeivkkhsqfigypitlfve

SCOPe Domain Coordinates for d5ocia_:

Click to download the PDB-style file with coordinates for d5ocia_.
(The format of our PDB-style files is described here.)

Timeline for d5ocia_:

  • d5ocia_ is new in SCOPe 2.07-stable