Lineage for d5wfon_ (5wfo N:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338409Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 2338410Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 2338411Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. 2338412Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 2338413Species Human (Homo sapiens) [TaxId:9606] [48369] (60 PDB entries)
    Uniprot Q07889 189-1046
  8. 2338456Domain d5wfon_: 5wfo N: [352659]
    Other proteins in same PDB: d5wfoq_, d5wfor1, d5wfor2
    automated match to d1nvus_
    protein/DNA complex; complexed with 5uu, gnp, mg

Details for d5wfon_

PDB Entry: 5wfo (more details), 1.99 Å

PDB Description: ligand-bound ras:sos:ras complex
PDB Compounds: (N:) Son of sevenless homolog 1

SCOPe Domain Sequences for d5wfon_:

Sequence, based on SEQRES records: (download)

>d5wfon_ a.117.1.1 (N:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d5wfon_ a.117.1.1 (N:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkianitfqssp
ptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeins
pnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsam
nsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnil
kteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmg
nsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d5wfon_:

Click to download the PDB-style file with coordinates for d5wfon_.
(The format of our PDB-style files is described here.)

Timeline for d5wfon_: