Lineage for d5yisa_ (5yis A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932747Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (3 species)
  7. 2932750Species Mouse (Mus musculus) [TaxId:10090] [419783] (2 PDB entries)
  8. 2932751Domain d5yisa_: 5yis A: [352643]
    automated match to d2zjdc_
    complexed with gol, po4

Details for d5yisa_

PDB Entry: 5yis (more details), 2.2 Å

PDB Description: crystal structure of ankb lir/lc3b complex
PDB Compounds: (A:) Microtubule-associated proteins 1A/1B light chain 3B

SCOPe Domain Sequences for d5yisa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yisa_ d.15.1.3 (A:) Microtubule-associated proteins 1A/1B light chain 3B {Mouse (Mus musculus) [TaxId: 10090]}
ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe

SCOPe Domain Coordinates for d5yisa_:

Click to download the PDB-style file with coordinates for d5yisa_.
(The format of our PDB-style files is described here.)

Timeline for d5yisa_: