![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
![]() | Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [419783] (2 PDB entries) |
![]() | Domain d5yisa_: 5yis A: [352643] automated match to d2zjdc_ complexed with gol, po4 |
PDB Entry: 5yis (more details), 2.2 Å
SCOPe Domain Sequences for d5yisa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yisa_ d.15.1.3 (A:) Microtubule-associated proteins 1A/1B light chain 3B {Mouse (Mus musculus) [TaxId: 10090]} ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe
Timeline for d5yisa_: